Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Common NameBZR1, OsI_26618
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family BES1
Protein Properties Length: 298aa    MW: 31908.7 Da    PI: 8.6003
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA024018-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
            DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspess 93 
                       +++gr+ptwkErEnnkrRERrRRaiaaki++GLRa Gny+lpk++DnneVlkALcreAGwvvedDGttyrkg+kp+  ++a+g+s  +sp+ss
                       589*************************************************************************.9999************ PP

            DUF822  94 lq.sslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlsl 145
                       +q +s+ ss+++spv+sy+asp+sssfpsps++d+ s+   ++llp+l+ l++
                       *********************************99866...588888876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.9E-648132IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0040008Biological Processregulation of growth
GO:0042742Biological Processdefense response to bacterium
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.547810.0callus| flower| leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Functional Description ? help Back to Top
Source Description
UniProtPositive brassinosteroid-signaling protein. Mediates downstream brassinosteroid-regulated growth response and feedback inhibition of brassinosteroid biosynthetic genes. May act as transcriptional repressor by binding the brassinosteroid-response element (5'-CGTGCG-3') in the promoter of GRAS32 (AC Q9LWU9), another positive regulator of brassinosteroid signaling (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00073ChIP-chipTransfer from AT1G19350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1067480.0AK106748.1 Oryza sativa Japonica Group cDNA clone:002-115-C06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645123.10.0PREDICTED: protein BZR1 homolog 1
SwissprotB8B7S50.0BZR1_ORYSI; Protein BZR1 homolog 1
SwissprotQ7XI960.0BZR1_ORYSJ; Protein BZR1 homolog 1
TrEMBLA0A0E0QAC11e-175A0A0E0QAC1_ORYRU; Uncharacterized protein
TrEMBLI1QEM41e-175I1QEM4_ORYGL; Uncharacterized protein
STRINGLOC_Os07g39220.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA024018-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.32e-80BES1 family protein